Zeolite Catalysis

PDF Publication Title:

Zeolite Catalysis ( zeolite-catalysis )

Previous Page View | Next Page View | Return to Search List

Text from PDF Page: 158

with the TEM results and was likely caused due to the increase in the domain-size of the ordered mesostructure [25]. The wide-angle XRD patterns of both the composites (Figure 3B) exhibit the same characteristic diffraction peaks as those of the pristine TS-1, assigned to the typical MFI structure. The lower diffraction intensity is probably due to the shielding effects of the mesosilica shell. Catalysts 2015, 5 2137 Figure 2. Low- moderate- and high-magnification TEM images of (a–c) pristine TS-1; Figure 2. Low- moderate- and high-magnification TEM images of (a–c) pristine (d–f) CS-TS-1@mSiO2-30 and (g–i) CS-TS-1@mSiO2-50. TS-1; (d–f) CS-TS-1@mSiO2-30 and (g–i) CS-TS-1@mSiO2-50. The nanoporous structure of CS-TS-1@mSiO2 composites was further characterized by XRD and In the N2 sorption analysis, the pristine TS-1 shows a type-I isotherm according nitrogen sorption analysis. Apparently, the small-angle XRD pattern of CS-TS-1@mSiO2-30 (Figure 3A) to the IUPAC (International Union of Pure and Applied Chemistry) classification shows a broad diffraction peak at a 2θ value of approximately 2.4° whereas pristine TS-1 shows no withasharpuptakeintheP/P range0–0.01,acharacteristicbehaviorofcompletely 0 diffraction peaks. This suggests an unordered mesostructure in mSiO2 shell. Moreover, a broad microporous materials (Figure 3C). On the other hand, the CS-TS-1@mSiO diffraction peak with higher intensity and a weak diffraction peak are simultaneously present at 2θ valu2es composites with different shell thickness (30 nm or 50 nm) exhibit a similar of 2.4° and 4.8° in the small-angle XRD pattern of CS-TS-1@mSiO2-50 (Figure 3A), revealing that the muepsotachkaennaetlslionwmSPiO/2P0she(ltlyapre-pIarctulyrvoerdse)r;edh.oTwhesveerre,sualtns iandidcaiteiotnhatlthuepotradkeer dfeoglrleoewoifntghe mtyespoicchalnnteylpsein-cIrVeasceudrwviethsiwncirtehaseaincathpeiltlhaicrkynecsosnodfethnesmatSiioOn2sshtelpl,wahpicpheiasrisnactcomrdoadnceerawtieth thPe/PTEM(0.r2e–s0ul.t6s).anAddwiastilnikcetlyhycsatueseredsidsuelotopthoefiHnc2retaysepeinisthaelsdoomclaeina-rsliyzeoobfsethrveeodrdfeorerd 0 mesostructure [25]. The wide-angle XRD patterns of both the composites (Figure 3B) exhibit the same both the composites. These phenomena reveal the bimodal-pore properties of the characteristic diffraction peaks as those of the pristine TS-1, assigned to the typical MFI structure. The CS-TS-1@mSiO2 composites from micropores to mesopores as well as the accessible lower diffraction intensity is probably due to the shielding effects of the mesosilica shell. microporous ZSM-5 cores covered with a mesoporous silica shell. Moreover, in In the N2 sorption analysis, the pristine TS-1 shows a type-I isotherm according to the IUPAC (International Union of Pure and Applied Chemistry) classification with a sharp uptake in the P/P0 range 143 0–0.01, a characteristic behavior of completely microporous materials (Figure 3C). On the other hand, the CS-TS-1@mSiO2 composites with different shell thickness (30 nm or 50 nm) exhibit a similar uptake at low P/P0 (type-I curves); however, an additional uptake following typical type-IV curves with a

PDF Image | Zeolite Catalysis

PDF Search Title:

Zeolite Catalysis

Original File Name Searched:

Zeolite_Catalysis.pdf

DIY PDF Search: Google It | Yahoo | Bing

NFT (Non Fungible Token): Buy our tech, design, development or system NFT and become part of our tech NFT network... More Info

IT XR Project Redstone NFT Available for Sale: NFT for high tech turbine design with one part 3D printed counter-rotating energy turbine. Be part of the future with this NFT. Can be bought and sold but only one design NFT exists. Royalties go to the developer (Infinity) to keep enhancing design and applications... More Info

Infinity Turbine IT XR Project Redstone Design: NFT for sale... NFT for high tech turbine design with one part 3D printed counter-rotating energy turbine. Includes all rights to this turbine design, including license for Fluid Handling Block I and II for the turbine assembly and housing. The NFT includes the blueprints (cad/cam), revenue streams, and all future development of the IT XR Project Redstone... More Info

Infinity Turbine ROT Radial Outflow Turbine 24 Design and Worldwide Rights: NFT for sale... NFT for the ROT 24 energy turbine. Be part of the future with this NFT. This design can be bought and sold but only one design NFT exists. You may manufacture the unit, or get the revenues from its sale from Infinity Turbine. Royalties go to the developer (Infinity) to keep enhancing design and applications... More Info

Infinity Supercritical CO2 10 Liter Extractor Design and Worldwide Rights: The Infinity Supercritical 10L CO2 extractor is for botanical oil extraction, which is rich in terpenes and can produce shelf ready full spectrum oil. With over 5 years of development, this industry leader mature extractor machine has been sold since 2015 and is part of many profitable businesses. The process can also be used for electrowinning, e-waste recycling, and lithium battery recycling, gold mining electronic wastes, precious metals. CO2 can also be used in a reverse fuel cell with nafion to make a gas-to-liquids fuel, such as methanol, ethanol and butanol or ethylene. Supercritical CO2 has also been used for treating nafion to make it more effective catalyst. This NFT is for the purchase of worldwide rights which includes the design. More Info

NFT (Non Fungible Token): Buy our tech, design, development or system NFT and become part of our tech NFT network... More Info

Infinity Turbine Products: Special for this month, any plans are $10,000 for complete Cad/Cam blueprints. License is for one build. Try before you buy a production license. May pay by Bitcoin or other Crypto. Products Page... More Info

CONTACT TEL: 608-238-6001 Email: greg@infinityturbine.com (Standard Web Page)