PDF Publication Title:
Text from PDF Page: 007
Nanomaterials 2020, 10, x FOR PEER REVIEW 7 of 14 Nanomaterials 2020, 10, 892 7 of 14 gradient. The surrounding glass substrate retracts heat out of the edges of the silver pattern; therefore, hthigehinpkerecdegnetasgweiolfltrheemraidniastliognhtalyndcoqludiecrkltyhahneatthseucpe,nctrerataindgathcuosnsidneterrabalteatesmlopwerearturareteg.rOadniethnet. Nanomaterials 2020, 10, x FOR PEER REVIEW 7 of 14 Tcohnetsrauryro, huenadtinisghgolmasosgseunbesotruastleyrdeitsrtarcitbsuhtedatoovuetrothf ethwe heodlgeesaomf pthle dsiulvrienrgpoavttenrns;inthterienfgo,rer,esthueltingk gradient. The surrounding glass substrate retracts heat out of the edges of the silver pattern; therefore, eindgaehsowmiollgrenmeaoiunsstliegmhptleyrcaotuldrerpthroafniltehiemcpenotseinr ganthdethsaums seinsitnerteartinagslsopweerdroavte.rOthnetshaemcopnletr.aHryo,wheavteirs, the ink edges will remain slightly colder than the center and thus sinter at a slower rate. On the hsomeogselingehotuisnlhyodmisotrgiebnueteodusoveemritshseivwithyoclaensabmepolbesderuvreindgionvFeingusirnete5ri(n2g0,arensdul3t0inmgin)a,chaoumseodgebnyeothues contrary, heat is homogeneously distributed over the whole sample during oven sintering, resulting tdeimffeprernacteurien pinrokfillaeyeimr tphoisciknngestshedusaemtoe tshinetperingtinsgpeperdocoevsseratnhde csoafmfepeleri.ngHfowrmevaetiro, ns.omLoecastliognhst in a homogeneous temperature profile imposing the same sintering speed over the sample. However, iwnheormeotghenienokulsaeymerisisitvhitiyckcearnrbeequoibrseemrvoerdeitnimFiegutoresi5n(t2e0r athnadn3l0omcaitnio),ncsawusheedrebythteheindkifflaeyrenrcies ifnaiirnlyk some slight inhomogeneous emissivity can be observed in Figure 5 (20 and 30 min), caused by the ltahyinenr ethr.ickness due to the printing process and coffee ring formation. Locations where the ink layer is difference in ink layer thickness due to the printing process and coffee ring formation. Locations thicker require more time to sinter than locations where the ink layer is fairly thinner. where the ink layer is thicker require more time to sinter than locations where the ink layer is fairly thinner. Figure 4. Average and spot emissivity during sintering correlate with the resulting sheet resistance of Figure 4. Average and spot emissivity during sintering correlate with the resulting sheet resistance of Figure 4. Average and spot emissivity during sintering correlate with the resulting sheet resistance of the ink layer for (A) NIR sintered JS-B40G ink and (B) oven sintered JS-B40G ink. the ink layer for (A) NIR sintered JS-B40G ink and (B) oven sintered JS-B40G ink. the ink layer for (A) NIR sintered JS-B40G ink and (B) oven sintered JS-B40G ink. Figure 5. (E40) thermal images of the emissivity progression during sintering. Top row; NIR sintered Figure 5. (E40) thermal images of the emissivity progression during sintering. Top row; NIR sintered JS-B40G. Bottom row; oven sintered JS-B40G. Dark areas have low emissivity; yellow areas have high Figure 5. (E40) thermal images of the emissivity progression during sintering. Top row; NIR sintered JS-B40G. Bottom row; oven sintered JS-B40G. Dark areas have low emissivity; yellow areas have emissivity. JS-B40G. Bottom row; oven sintered JS-B40G. Dark areas have low emissivity; yellow areas have high high emissivity. emissivity. 3.3. Importance of Ink Optimization for NIR Sintering 3.3. Importance of Ink Optimization for NIR Sintering 3.3. ImportaTnhce doifrIenckt iOmptriomviezmateionnt ofof rNNIRIRsinStienrtienrgindguration versus oven sintering, presented in Figure 2, Thliesdinirethcet liomcaplrhoevaetimngeneftfoecft.NVIaRndsienvtenrninegetdaul.rmatiimonickveedrsthueslovcaelntesminpteraitnugr,epwrietsheonvtendsintFeriginugre 2, The direct improvement of NIR sintering duration versus oven sintering, presented in Figure 2, liesinathnedlsohcoawlehdeathtienegveofflveecmt.eVnatnofdtehveedninffereetnatls.inmteimrinicgksetedptshbeylopcearflotreminpgeraattoumriecwfoirtcheomviecnrosicnotpeering lies in the local heating effect. Vandevenne et al. mimicked the local temperature with oven sintering (AFM) measurements after heating in an oven at different temperatures up to 400 °C [10]. It could be and showed the evolvement of the different sintering steps by performing atomic force microscope and shobwserdvetdhetheavt othlveelmoceanl teomf pthereatduirfefenreendtsstiontgeoriwngellstaebposveby20p0e°rCfotromaicnhgieavteoqmuickf◦osrinceterminigcraonsdcope (AFM) measurements after heating in an oven at different temperatures up to 400 C [10]. It could (AFM)nmecekainsguroefmthenntasnaofptearthiceleastitnogfoinrmanbigogvern(caltudstiefrfedre) npat rtteicmlepseorpattiumriez◦sinugpthteo p4e0r0co°lCati[o1n0]p. aIthc.oInulad be be observed that the local temperature needs to go well above 200 C to achieve quick sintering well calibrated oven set at a temperature of 200 °C, the local temperature is limited to this setpoint observed that the local temperature needs to go well above 200 °C to achieve quick sintering and and necking of the nanoparticles to form bigger (clustered) particles optimizing the percolation value, leading to a longer required sintering duration. For NIR sintering however, as presented in necking of the nanoparticles to form bigger (clustered) particl◦es optimizing the percolation path. In a path. In a well calibrated oven set at a temperature of 200 C, the local temperature is limited to Figure 6, the heat absorption of the nanoparticles according to their specific absorption spectrum is well calibrated oven set at a temperature of 200 °C, the local temperature is limited to this setpoint this setpoint value, leading to a longer required sintering duration. For NIR sintering however, more efficient. Hence, the local heating effect will not only include higher temperatures but also the value, leading to a longer required sintering duration. For NIR sintering however, as presented in as presented in Figure 6, the heat absorption of the nanoparticles according to their specific absorption Figure 6, the heat absorption of the nanoparticles according to their specific absorption spectrum is spectrum is more efficient. Hence, the local heating effect will not only include higher temperatures more efficient. Hence, the local heating effect will not only include higher temperatures but also thePDF Image | Nanoparticle Inkjet Inks for Near-Infrared Sintering
PDF Search Title:
Nanoparticle Inkjet Inks for Near-Infrared SinteringOriginal File Name Searched:
nanomaterials-10-00892.pdfDIY PDF Search: Google It | Yahoo | Bing
Turbine and System Plans CAD CAM: Special for this month, any plans are $10,000 for complete Cad/Cam blueprints. License is for one build. Try before you buy a production license. More Info
Waste Heat Power Technology: Organic Rankine Cycle uses waste heat to make electricity, shaft horsepower and cooling. More Info
All Turbine and System Products: Infinity Turbine ORD systems, turbine generator sets, build plans and more to use your waste heat from 30C to 100C. More Info
CO2 Phase Change Demonstrator: CO2 goes supercritical at 30 C. This is a experimental platform which you can use to demonstrate phase change with low heat. Includes integration area for small CO2 turbine, static generator, and more. This can also be used for a GTL Gas to Liquids experimental platform. More Info
Introducing the Infinity Turbine Products Infinity Turbine develops and builds systems for making power from waste heat. It also is working on innovative strategies for storing, making, and deploying energy. More Info
Need Strategy? Use our Consulting and analyst services Infinity Turbine LLC is pleased to announce its consulting and analyst services. We have worked in the renewable energy industry as a researcher, developing sales and markets, along with may inventions and innovations. More Info
Made in USA with Global Energy Millennial Web Engine These pages were made with the Global Energy Web PDF Engine using Filemaker (Claris) software.
Infinity Turbine Developing Spinning Disc Reactor SDR or Spinning Disc Reactors reduce processing time for liquid production of Silver Nanoparticles.
| CONTACT TEL: 608-238-6001 Email: greg@infinityturbine.com | RSS | AMP |